HORDB

ID: hor006322
Uniprot ID: Q99134
Protein name: PGLa
Gene name: pgla-a
Organism: Xenopus laevis (African clawed frog)
Family: Gastrin/cholecystokinin family, Magainin subfamily
Source: Animal
Expression: Expressed by the skin glands. Synthesized in the stomach and stored in a novel granular multinucleated cell in the gastric mucosa. Stored as active, processed peptides in large granules within the granular gland secretions of the skin.
Disease: NA
Comments: NA
Taxonomy: Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: NA
GO BP: GO:0006952 defense response; GO:0031640 killing of cells of another organism; GO:0042742 defense response to bacterium; GO:0050832 defense response to fungus
GO CC: GO:0005576 extracellular region

Sequence: GMASKAGAIAGKIAKVALKAL
Length: 21(39-59)
Propeptide: MYKQIFLCLIIAALCATIMAEASAFADADEDDDKRYVRGMASKAGAIAGKIAKVALKALGRRDS
Signal peptide: MYKQIFLCLIIAALCATIMA
Modification: T21 Leucine amide
Glycosylation: NA
Mutagenesis: NA

Function: PGLa and PGLa-H display a broad-spectrum of antibacterial activity against a range of Gram-positive and Gram-negative bacteria. PGLa also displays antifungal activity against C.albicans ATCC 14053. PGLa-H shows moderate antibacterial activity against the
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006322_AF2.pdb

hor006322_ESM.pdb

Mass:	232642	Formula:	C88H161N25O23S
Absent amino acids:	CDEFHNPQRTWY	Common amino acids:	A
pI:	11.28	Basic residues:	4
Polar residues:	4	Hydrophobic residues:	12
Hydrophobicity:	84.29	Boman Index:	1596
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	121.43
Instability Index:	-481.43	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 6688991
Title: A novel peptide designated PYLa and its precursor as predicted from cloned mRNA of Xenopus laevis skin.
PubMed ID: 2465151
Title: The genes for the frog skin peptides GLa, xenopsin, levitide and caerulein contain a homologous export exon encoding a signal sequence and part of an
PubMed ID: 3606567
Title:
PubMed ID: 1717472
Title:
PubMed ID: 22014884
Title: